4,319 Free Images of Fields In The United States

grasscc-zeroanimalssportruralgamelandscapevehiclemilitaryaircraft
US Navy 070815-N-9860Y-002 A poster to remember members of Explosive Ordnance Disposal Mobile Unit (EODMU) 11 is displayed at a ceremony to rename drop zones in their honor
united states navy explosive ordnance disposalexplosive ordnance disposal mobile unit 11
US Navy 061206-N-3560G-022 Equipment Operator 1st Class (SCW) Simon Wyant and Steelworker 3rd Class Jessica Stager of Naval Mobile Construction Battalion Four (NMCB-4) prepare to clear a building of unknown threats during field
fort hunter liggettarmy
A pronghorn stands in a field dotted by arrowleaf balsamroot, a yellow flower in the sunflower family (Asteraceae) commonly found in mountain fields in the western United States. Credit: USFWS / Barb
wildlifeanimals
US Navy 090526-N-7975R-011 Cmdr. Curt Jones, commanding officer of Pre-Commissioning Unit (PCU) New York (LPD-21), presides over a swearing-in ceremony at Frontier Field
images from united states navy to checkpeople
Menno Hall (Hamilton Co KS) cistern 2
fieldrural
Ferruginous hawk soaring overhead, Malta Field Office, July 1991.
animalsbird
US Navy 120131-N-UE250-026 A Sailor commands police dog, Mickey, to attack
fieldgame
USS Ronald Reagan marks namesake's birthday DVIDS150117
landscapegrass
US Navy 110324-N-UX336-062 Cmdr. Mark Becker, the mission commander of Southern Partnership Station (SPS), fields question
united states navy images from corintovehicle
Steve Stone interviews Mike Mullen
interviews in the united statesguaranteed rate field
P-3A VP-46 at NAS Moffett Field 1965
militaryvehicle
US Navy 090527-N-7975R-014 Musician 1st Class Ira Ostrowski, assigned to the Naval Academy Band the
united states naval academy bandfrontier field
bird's-eye speedwell (Veronica persica)
naturespring
US Navy 060904-N-4097B-031 A U.S. Army Soldier from 1st Battalion, 68th Combined Arms Regiment, 3rd Heavy Brigade Combat Team, 4th Infantry Division stands guard in a field near Tafaria, Iraq
grassgreen
US Navy 100317-N-7948C-039 Air Force Capt. Paulencia Morris and Staff Sgt. Jennifer Hurley examine a Ghanaian woman during a dental outreach program at Manhean Health Center
women in medicinepeople
Andre Williams (American football) 2012
sportgame
US Navy 070619-N-3857R-007 Personnel Specialist 3rd Class Ray Guedry, of Naval Mobile Construction Battalion (NMCB) 1, guards the ambulance while others secure a perimeter during Operation Desert Heat, a graded field exercise
militaryarmy
Photo taken July, 2005, at Strouds Run State Park, Ohio. Field trial of American chestnut seedling.
plantsgreen
Chadwick Arboretum and Learning Gardens Arboretum North The Ohio State University Columbus, Ohio
landscapetree
US Navy 111022-N-YR391-054 Senior Chief Missile Technician Jeff Norris catches the first pitch from his son at the Miracle Field grand opening in C
sportgame
US Navy 111219-M-OO345-001 Marines and Sailors assigned to the 11th Marine Expeditionary Unit (11th MEU) participate in a live-fire exercise
grassfield
Major league baseball baseball stadium american
baseballusa
US Navy 090207-N-7090S-028 Lt. j.g. Jenny McDonagh warms-up prior to the 8 Kilometer women's race
marylandfield
Hall PH and Stinson Reliant at CGAS Brooklyn 1938
monochromeaircraft
Greater sage-grouse lek near Bodie, California. (Jeannie Stafford/USFS)
animalsbird
Type of Bulls on the Burns C&H Range, Myrtle Park, Maheur Forest, 1917. - NARA - 299137
animalsfield
Image title: — Large Camas. Flowering in a field. Image from Public domain images website, http://www.public-domain-image.com/full-image/nature-landscapes-public-domain-images-pictures/field-public-d
plantsgrass
Operation Unified Response DVIDS245300
aircraftvehicle
Team Navy-Coast Guard competes at 2012 Warrior Games 120504-N-AN499-315
cadet outdoor track and field complexsport
Harvey House, 1780 - Old Austerlitz - Austerlitz, New York - DSC07545
architecturegrass
Omaha, Nebraska Westminster Presbyterian from S 1
self-published workarchitecture
Defense.gov News Photo 110715-N-KG738-238 - U.S. Army soldiers from the 38th Engineer Company 4th Stryker Brigade 2nd Infantry Division and sappers from Australia s 2nd Troop 1st Field
images from united states navy to checkdefense.gov news media for july 2011
A great blue heron fishes in a soybean field. Sustained heavy rain had caused widespread flooding in northwestern Ohio, and here the Auglaize River had far exceeded its banks and was flowing through
animalsbird
US Navy 070821-N-8547M-017 Builder 3rd Class James W. Strait, of Naval Mobile Construction Battalion (NMCB) 5, drinks through his protective mask during a chemical, biological and radiological protection drill in field exercise
fort hunter liggettpeople
Rural nature grass
landscapenature
Sky beach blue sea
landscapetravel
Omaha, Nebraska 3520 Woolworth Ave
self-published workvillage
Douglas B-18 flying field 061128-F-1234S-019
black and whitemonochrome
Donald Rumsfeld, Ariel Sharon, and Thomas Jordan inspects the troops at the River Parade Field
donald rumsfeld in 2001army
Northern Harrier Circus hudsonius, Lassen Volcanic National Park
animalsbird
Snowy egret from Branford Trolley Trail 194
grassfield
F4U Corsairs at Lambert Field c1950
aircraftvehicle
US Navy 100418-N-8848T-371 Navy ROTC Midshipman 4th Class Alex Songer, from St. Louis, patrols with her M-16A4 weapon during a field training exercise
camp atterburymilitary
Flag of Arapaho Nation
white stripeschevron
Alabama montana dothan
landscapenature
Whittier CA seen from Hellman park (Peppergrass) trail
grassfield
Lush tobacco
springplants
Log cabin scale meadow
naturetree
Bareford Mountains, West Milford, New Jersey, Jasper Francis Cropsey, circa 1850
landscape paintings by jasper francis cropseypaintings of new jersey
US Navy 110529-O-ZZ999-005 Lt. Jg. Kristen Laraway goes for a goal attempt during an exhibition soccer match for the Pacific Partnership 2011 socce
sportgame
SH-2F Seasprite of HSL-31 and SH-3H Sea King of HS-10 at NAAS Imperial Beach in 1977
aviationfly
Collin Mooney 2015
sportgame
US Navy 090806-N-8539M-205 Royal Brunei Land Force soldiers and U.S. Marines carry a simulated mudslide victim to a field hospital during a Cooperation Afloat Readiness and Training (CARAT) Brunei 2009 humanitarian and disaster
cooperation afloat readiness and training 2009united states navy images from brunei
February 15, 2012- Bell City, Louisiana: Geese out in the field. Photo by Corey Douglas www.fws.gov/swlarefugecomplex
animalsbird
Flight line at Naval Air Station Moffett Field, California (USA), on 17 December 1934 (NNAM.1996.253.1795)
monochromewhite
US Navy 090207-N-7090S-013 Lt. j.g. Will Christian leads a pack of runners during the Armed Forces Cross Country Championship
sportfield
US Navy 060818-N-0411D-082 U.S. Navy Cmdr. Dr. Warren Gilbert, left, of Reno, Nev., examines a patient with a mock head during field training
united states navy in nginyangcamp lonestar
Washington dc america
buildingsymbol
common cornsalad (Valerianella locusta)
rapunzelplants
Menno Hall (Hamilton Co KS) cistern 1
grassfield
US Navy 060818-N-0411D-079 U.S. Navy Cmdr. Dr. Warren Gilbert, left, of Reno, Nev., examines a patient with a mock head during field training
united states navy in nginyangcamp lonestar
US Navy 080621-N-1120L-013 Builder 1st Class Eric Scott, assigned to Naval Mobile Construction Battalion (NMCB) 7, discusses the Forward Operations Base's security plan with fellow Seabees during the battalion's unit field exer
builder (united states navy)camp shelby
Nicholas II of Russia, 1900s
list of monarchs and heads of state of finlandnicholas ii (lipgart)
Race color competition
animalsrunning
US Navy 080823-N-9689V-004 Sailors assigned to the Military Sealift Command hospital ship USNS Mercy (T-AH 19) play basketball with residents of Weno Island at a local field
united states navy images from chuuksport
US Navy 070713-N-8547M-050 Culinary Specialist 1st Class Derrick R. Wilson of Naval Mobile Construction Battalion (NMCB) 5 finds concealment to scan the terrain for enemy movement while taking part in a reconnaissance patrol du
people wearing gas masks in the united statesfort hunter liggett
US Navy 110520-N-ZK021-009 Master-at-Arms 2nd Class Jerry Cotter, left, from Belding, Mich., assigned to base security, performs a mock field sobri
military police automobiles of the united statesmaster-at-arms
Chemical, Biological and Radiological Warfare Drill DVIDS124753
utilitiesmanpeople
Defense.gov News Photo 071112-N-0696M-289
images from united states navy to checkmichael g. mullen in 2007
US Navy 061206-N-3560G-009 Members of Naval Mobile Construction Battalion Four (NMCB-4) fieldstrip and clean their M16-A service rifle during field exercise Operation Bearing Duel
militaryarmy
US Navy 090227-N-1655H-009 Boatswain's Mate 3rd Class Joseph Kluempers, assigned to the amphibious transport dock ship USS Nashville (LPD 13), left, makes a move on a Ghanaian Navy defender
sportgame
US Navy 080113-N-8933S-073 Engineman 3rd Class Lawrence Cofie, assigned to the amphibious dock landing ship USS Fort McHenry (LSD 43) as part of Africa Partnership Station (APS), plays soccer with local Gabonese soccer players
fieldgame
Dawn dusk fair weather
landscapeflag
US Navy 100122-N-4378P-163 An earthquake victim is transported from the temporary triage facility, Terminal Varreux, to an MH-60S Sea Hawk helicopter
united states navy images from port-au-princefield
LastF14
militaryvehicle
Rural nature grass
landscapenature
FJ-3 Fury over McCalla Field Cuba 1962
aircraftvehicle
FJ-3 VF-62 at NAS Cecil Field 1956
militaryvehicle
US Navy 071110-N-8053S-155 Navy Midshipmen kicker, Joey Bullen, attempts to kick a field goal during the Navy vs. University of North Texas (UNT) football game
sportgame
One of two bald eagles were found dead in a field about 50 yards apart near Martinez Rd. in Thibodaux, LA. Poisoning is suspected. A GPS unit was placed near it as a size reference. Public Domain Pho
animalsbird
Flag of Guyana
with insigniachevron
US Navy 100312-N-0486G-002 Personnel Specialist Seaman Apprentice Bernardo Tavarez sorts through a field service record at Personnel Support Detachment Mayport
personnel specialist (united states navy)people at naval station mayport
FJ-4 VU-7 at NAAS Brown Field 1960
militaryvehicle
Rural nature grass
landscapenature
101015-N-9564W-026 (5096890907)
militaryarmy
Endeavour escorts 1255
self-published workpages with maps
US Navy 110430-N-KB563-145 A Sailor plays soccer with local children during a community service project at Unity Park
sportfield
US Navy 111206-N-AC887-002 Secretary of the Navy (SECNAV) the Honorable Ray Mabus addresses Sailors and Marines at Marine Corps Base, Kaneohe Bay
fieldlawn
Blackcurrant 1
agriculturegrass
US Navy 070601-N-8497H-066 A member of the U.S. Navy Parachute Team lands on the football field of Bishop McGuiness Catholic High School
united states navy images from oklahoma cityoklahoma city navy week
Endeavour escorts 1256
self-published workpages with maps
US Army Field Range No. 2, 1918 - Fort Devens Museum - DSC07199
cook stoveinside
Observation Tripod for Use in Taking Fur-Seal Census Subject: Northern fur seals, Animals--Counting Tag: Aquatic Mammals
animalsmammals
US Navy 100806-N-4440L-051 Equipment Operator Construction Apprentice Steven Lott dons his chemical, biological, radiological (CBR) gear during a mission oriented protective posture (MOPP) level 4 drill
mississippipeople
A juvenile Whooping Crane tests its wings shortly after being released from a holding pen on Wheeler National Wildlife Refuge. Photo by Bill Gates, USFWS Feb. 10, 2012
animalsbird
Image title: Baldtop iris and buttercup cover a prairie hillside Image from Public domain images website, http://www.public-domain-image.com/full-image/flora-plants-public-domain-images-pictures/flowe
springflag
US Navy 100119-N-6266K-017 Hundreds of displaced Haitians live in make-shift homes outside Gheskio Field Hospital in Haiti
2010 haiti earthquake relief efforts in port-au-princejanuary 2010 in port-au-prince
US Navy 070821-N-8547M-029 Seabees of Naval Mobile Construction Battalion (NMCB) 5 participate in a chemical, biological and radiological drill in field exercise Operation Bearing Duel 6-07
fort hunter liggettpeople
Apple store opens on iWatch day 2015 -06-10 jeh
self-published workpages with maps
Lebanon Church (Grant Co, SD) from NW 3 with cemetery
architecturegrass
901 - 1000 of 4,319 Next page
/ 44